You have no items in your shopping cart.
Human SDF1 protein (Active)
SKU: orb359059
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 8.5 kDa |
| Expression Region | 22-93aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−C-X-C motif chemokine 12 protein, CXCL12 protein, CXCL-12 protein, CXCL 12 protein, hIRH protein, hSDF-1 protein, Intercrine reduced in hepatomas protein, IRH protein, PBSF protein, SCYB12 protein, SDF 1 alpha protein, SDF 1 protein, SDF 1 beta protein, SDF 1b protein, SDF-1 protein, SDF-1a protein, SDF-1b protein, SDF1 protein, SDF1a protein, SDF1b protein, Stromal cell derived factor 1 protein, TLSF a protein, TLSF protein, TLSF b protein, TLSF-a protein, TLSF-b protein, TLSFa protein, TLSFb protein, TPAR1 protein
Similar Products
−Human SDF1 protein (Active) [orb359058]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman SDF1 protein (Active) [orb359060]
> 96% as determined by SDS-PAGE and HPLC.
11.6 kDa
E.Coli
500 μg, 100 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human SDF1 protein (Active) (orb359059)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
