You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605537 |
---|---|
Category | Proteins |
Description | Recombinant Human Protein S100-A14(S100A14) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 13.7 kDa |
UniProt ID | Q9HCY8 |
Protein Sequence | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH |
Protein Length | Full Length |
Source | Yeast |
Expression System | Expression Region: 1-104aa. Protein Length: Full Length |
Expression Region | 1-104aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | S100 calcium-binding protein A14 Short name, S114 Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
12.5 kDa | |
Human S100A14, His Tag (orb257816) is expressed from E.coli cells. It contains AA Met 1 - His 104 (Accession # Q9HCY8-1). |
Greater than 90% as determined by SDS-PAGE. | |
38.7 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
27.7 kDa | |
Yeast |
Filter by Rating