Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1-2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human S100A12 protein
Catalog Number orb54268
ReactivityHuman
ConjugationUnconjugated
Sequence Full Length of Mature Protein
Target S100A12
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal GST-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Purity >90% as determined by SDS-PAGE.
MW 37.4 kDa
Source E.coli
Expression Region 2-92aa
Uniprot ID P80511
Product Description

Recombinant human S100A12 protein

Application Notes
Application Notes N-terminal GST-tagged: N-terminal GST-tagged
1-166AA: 1-92AA
Full Length : Full Length
Reviews
Write Your Own Review
You're reviewing:Human S100A12 protein - orb54268
Your Rating