Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 1-2 weeks
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | Human S100A12 protein |
---|---|
Catalog Number | orb54268 |
Reactivity | Human |
Conjugation | Unconjugated |
Sequence | Full Length of Mature Protein |
Target | S100A12 |
Product Properties
Form/Appearance | Tris-based buffer, 50% glycerol |
---|---|
Storage | Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°. |
Tag | N-terminal GST-tagged |
Note | For research use only. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Protein Sequence | TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Purity | >90% as determined by SDS-PAGE. |
MW | 37.4 kDa |
Source | E.coli |
Expression Region | 2-92aa |
Uniprot ID | P80511 |
Product Description
Recombinant human S100A12 protein
Application Notes
Application Notes | N-terminal GST-tagged: N-terminal GST-tagged 1-166AA: 1-92AA Full Length : Full Length |
---|
Reviews
Write Your Own Review