Human RPS3 protein

SKU: orb604360

Description

This Human RPS3 protein spans the amino acid sequence from region 2-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 42.6 kDa
• Expression Region: 2-243aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

40S ribosomal protein S3, fb13d09, FLJ26283, FLJ27450, IMR 90 ribosomal protein S3, MGC56088, MGC87870, OTTHUMP00000229804, OTTHUMP00000229805, OTTHUMP00000229874, OTTHUMP00000229877, OTTHUMP00000229878, OTTHUMP00000229879, OTTHUMP00000229880, OTTHUMP00000229882, OTTHUMP00000229883, OTTHUMP00000229886, Ribosomal protein S3, rps3, RS3_HUMAN, S3, wu, fb13d09, zgc, 56088

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P23396