You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244499 |
---|---|
Category | Proteins |
Description | Recombinant human Tyrosine-protein kinase transmembrane receptor ROR1 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 44.6 kDa |
UniProt ID | Q01973 |
Protein Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 30-391aa. Protein Length: Partial |
Expression Region | 30-391aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | ROR1 Read more... |
Note | For research use only |
Application notes | Extracellular domain of His-tag and expression region is 30-391aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
43.5 kDa | |
Rat ROR1, His Tag (orb18509) is expressed from human 293 cells (HEK293). It contains AA Gln 30 - Glu 403 (Accession # EDL97819). |
Unconjugated | |
95% | |
42.9 kDa | |
Mouse ROR1, His Tag (orb257797) is expressed from human 293 cells (HEK293). It contains AA Gln 30 - Glu 403 (Accession # Q9Z139). |
Unconjugated | |
95% | |
68.4 kDa | |
Mouse ROR1, Fc Tag (orb257798) is expressed from human 293 cells (HEK293). It contains AA Gln 30 - Glu 403 (Accession # Q9Z139). |
Greater than 95% as determined by SDS-PAGE. | |
44.8 kDa | |
Mammalian cell |
Filter by Rating