You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb244496 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Non-secretory ribonuclease |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P10153 |
| MW | 19.5 kDa |
| Application notes | Full length of His-tag and expression region is 28-161aa |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 28-161aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | RNASE2 EDN RNS2 |
| Research Area | Immunology & Inflammation |
| Note | For research use only |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
17.0 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
44.4 kDa | |
Mammalian cell |
>90% as determined by SDS-PAGE. | |
17.77 kDa |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review