Human RB1 Protein

• Catalog Number: orb428081
• Category: Proteins
• Description: Recombinant of human RB1 protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The RB1 was lyophilized from 1xPBS pH-7.4.
• Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Protein Sequence: MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
• Application notes: Recombinant & Natural Proteins
• Source: Escherichia Coli
• Solubility (25°C): It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
• Storage: Stability: Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Alternative names: RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINO
• Note: For research use only
• Expiration Date: 6 months from date of receipt.