You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PYY protein
Catalog Number: orb605376
| Catalog Number | orb605376 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Peptide YY(PYY),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY |
| Protein Length | Partial |
| UniProt ID | P10082 |
| MW | 6.1 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 31-64aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | PYY-I (PYY) |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IAPP protein [orb605340]
Greater than 90% as determined by SDS-PAGE.
5.9 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human PYY protein [orb604337]
Greater than 90% as determined by SDS-PAGE.
31.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human PYY protein [orb604338]
Greater than 90% as determined by SDS-PAGE.
8.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human IAPP protein [orb604173]
Greater than 90% as determined by SDS-PAGE.
31.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human PYY Protein, hFc Tag [orb1290818]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 30.5 kDa after removal of the signal peptide.The apparent molecular mass of hFc-PYY is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
