You have no items in your shopping cart.
Human PTN protein (Active)
SKU: orb359183
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been precoated with 100 µl/well of a solution of 510 µg/ml rHuPTN. |
| Tag | Tag-Free |
| Molecular Weight | 15.3 kDa |
| Expression Region | 33-168aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
| Purity | > 96% as determined by SDSPAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PTN, HBBM, Heparin-binding growth factor 8, HBGF-8, Heparin-binding growth-associated molecule
Similar Products
−Recombinant Human Pleiotrophin protein(PTN) (Active) [orb1650568]
>96% as determined by SDS?PAGE and HPLC.
15.3 kDa
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SDS-PAGE analysis of Human PTN protein (Active)
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human PTN protein (Active) (orb359183)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review