You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604332 |
---|---|
Category | Proteins |
Description | Recombinant Human Myeloblastin(PRTN3) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 31.7 kDa |
UniProt ID | P24158 |
Protein Sequence | IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 28-248aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | AGP7 (C-ANCA antigen) (Leukocyte proteinase 3) (PR Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Human | |
0.78 ng/mL-50 ng/mL | |
0.195 ng/mL |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 39.3 kDa after removal of the signal peptide. The apparent molecular mass of IL18RAP-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Filter by Rating