You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PRSS3 protein
Catalog Number: orb604632
| Catalog Number | orb604632 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Trypsin-3(PRSS3),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN |
| Protein Length | Partial |
| UniProt ID | P35030 |
| MW | 28.2 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 81-303aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Brain trypsinogen, Mesotrypsinogen, Serine proteas Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human PRSS3 protein [orb754489]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
24.5 kDa
E.Coli
1 mg, 50 μg, 200 μg, 100 μgHuman PRSS3 Protein, His Tag [orb2700568]
> 95%, determined by SDS-PAGE
This protein contains the human PRSS3 isoform c (P35030-3) (Met 1-Ser 247) was expressed with a polyhistidine tag at the C-terminus and expressed from HEK293 Cells.
50 μg, 20 μgHuman PRSS3 (Sf9) Protein [orb427909]
Greater than 95.0% as determined by SDS-PAGE.
Sf9, Insect cells
1 mg, 2 μg, 10 μgHuman PRSS3 Protein [orb427908]
Greater than 90% as determined by SDS-PAGE.
Escherichia Coli
5 μg, 20 μg, 1 mg
