You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419332 |
---|---|
Category | Proteins |
Description | Recombinant Human papillomavirus type 16 E7 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
Protein Length | Full Length |
UniProt ID | P03129 |
MW | 15.1 kDa |
Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 1-98aaSequence Info: Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Human papillomavirus type 16 |
Expression Region | 1-98aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | E7, Protein E7 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.
FC, IF, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Greater than 90% as determined by SDS-PAGE. | |
38 kDa | |
E.coli |