You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PRLR protein
Catalog Number: orb419243
| Catalog Number | orb419243 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Prolactin receptor |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P16471 |
| MW | 71.9 kDa |
| Application notes | Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 25-622aaSequence Info: Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | in vitro E.coli expression system |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 25-622aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human PRLR Protein, hFc Tag [orb1290927]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 50.5 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
PRLR purified MaxPab rabbit polyclonal antibody (D01P) [orb2292335]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 2
Human PRLR Protein [orb1477833]
Greater than 95% as determined by SDS-PAGE.
27.2 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Human PRLR Protein, His Tag [orb1826877]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 25.8 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-His is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
