You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb427850 |
---|---|
Category | Proteins |
Description | Recombinant of human PRL R protein |
Form/Appearance | Sterile filtered white lyophilized powder. |
Buffer/Preservatives | The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3. |
Purity | Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.(c) Gel filtration at pH 8 under non denaturative conditions. |
Protein Sequence | AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW |
Application notes | Protein content: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics) |
Source | Escherichia Coli |
Biological Activity | Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions. |
Storage | Stability: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein |
Alternative names | PRL-R, hPRLrI. |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.5 kDa after removal of the signal peptide. The apparent molecular mass of PRLR-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 95% as determined by SDS-PAGE. | |
27.2 kDa | |
Mammalian cell |
Greater than 85% as determined by SDS-PAGE. | |
71.9 kDa | |
in vitro E.coli expression system |
Human | |
0.32-20 ng/mL | |
0.116 ng/mL |
>90% as determined by SDS-PAGE | |
26.7 kDa |