Human PRL R Protein

SKU: orb427850

Description

Recombinant of human PRL R protein

Images & Validation

• Application Notes:
  Protein content: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics)

Key Properties

• Source: Escherichia Coli
• Biological Activity: Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
• Protein Sequence: AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
• Purity: Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.(c) Gel filtration at pH 8 under non denaturative conditions.

Storage & Handling

• Storage: Stability: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein
• Form/Appearance: Sterile filtered white lyophilized powder.
• Buffer/Preservatives: The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
• Disclaimer: For research use only

Alternative Names

PRL-R, hPRLrI.