You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604707 |
---|---|
Category | Proteins |
Description | Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA) |
Tag | Tag-Free |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.9 kDa |
UniProt ID | P62937 |
Protein Sequence | VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 2-165aa. Protein Length: Full Length of Mature Protein |
Expression Region | 2-165aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Cyclophilin ACyclosporin A-binding proteinRotamase Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
44.9 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
23.0 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Human | |
3.12 ng/mL-200 ng/mL | |
0.78 ng/mL |
Filter by Rating