Human PLGF protein

• Catalog Number: orb419319
• Category: Proteins
• Description: Recombinant Human Placenta growth factor active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• MW: 17.3 kDa
• UniProt ID: P49763
• Protein Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Protein Length: Full Length of Isoform PlGF-2
• Source: E.Coli
• Expression System: Expression Region: 19-170aa. Protein Length: Full Length of Mature Protein of Isoform 3
• Biological Activity: Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.
• Expression Region: 19-170aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
• Alternative names: PlGF,
• Note: For research use only
• Application notes: Tag Info: NO-taggedExpression Region: 19-170aaSequence Info: Partial of Isoform VEGF165
• Expiration Date: 6 months from date of receipt.