Human PLGF protein

SKU: orb419319

Description

This Human PLGF protein spans the amino acid sequence from region 19-170aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  Tag Info: NO-taggedExpression Region: 19-170aaSequence Info: Partial of Isoform VEGF165

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 17.3 kDa
• Expression Region: 19-170aa
• Protein Length: Full Length of Mature Protein of Isoform 3
• Protein Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
• Disclaimer: For research use only

Alternative Names

PlGF,

Quick Database Links

UniProt

P49763