You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244434 |
---|---|
Category | Proteins |
Description | Recombinant human Placenta growth factor |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 33.3 kDa |
UniProt ID | P49763 |
Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Protein Length | Full Length of Mature Protein of Isoform PlGF-2 |
Source | E.coli |
Expression System | Expression Region: 19-170aa. Protein Length: Full Length of Mature Protein of Isoform PlGF-2 |
Expression Region | 19-170aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | PGF Read more... |
Note | For research use only |
Application notes | Full length of Isoform PlGF-2 of His-SUMO-tag and expression region is 19-170aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
84.1 kDa | |
Human VEGF R1 Protein, His Tag (orb1184768) is expressed from human 293 cells (HEK293). It contains AA Ser 27 - Asn 756 (Accession # P17948-1). |
Unconjugated | |
95% | |
96.5 kDa | |
Human NRP1, Fc Tag (orb257718) is expressed from human 293 cells (HEK293). It contains AA Phe 22 - Lys 644 (Accession # AAH07533). |
Unconjugated | |
92% | |
70.8 kDa | |
Human Neuropilin-1, His Tag (orb257717) is expressed from human 293 cells (HEK293). It contains AA Phe 22 - Lys 644 (Accession # AAH07533). |
Filter by Rating