Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human PGF protein
Catalog Number orb244434
Species/HostHuman
ConjugationUnconjugated
Target PGF
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Purity >90% as determined by SDS-PAGE.
MW 33.3 kDa
Source E. coli
Uniprot ID P49763
Product Description

Recombinant human Placenta growth factor

Application Notes
Application Notes Full length of Isoform PlGF-2 of His-SUMO-tag and expression region is 19-170aa
Reviews
Write Your Own Review
You're reviewing:Human PGF protein - orb244434
Your Rating