You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54496 |
---|---|
Category | Proteins |
Description | Recombinant human PEA15 protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
Protein Length | Full Length |
UniProt ID | Q15121 |
MW | 42 kDa |
Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-244AA: 1-130AAFull Length : Full Length |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 1-130aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | 15KDA phosphoprotein enriched in astrocytes Phosph Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
14.2 kDa | |
E.Coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human PEA15(Met1-Ala130) was fused without Tag and expressed in E. coli. |
Greater than 90.0% as determined by SDS-PAGE. | |
Escherichia Coli |