You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PEA15 protein
Catalog Number: orb54496
| Catalog Number | orb54496 |
|---|---|
| Category | Proteins |
| Description | Recombinant human PEA15 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
| Protein Length | Full Length |
| UniProt ID | Q15121 |
| MW | 42 kDa |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-244AA: 1-130AAFull Length : Full Length |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-130aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | 15KDA phosphoprotein enriched in astrocytes Phosph Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human PEA15 protein [orb392266]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgHuman PEA15 protein [orb755206]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
14.2 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgRecombinant Human PEA15 Protein, No Tag [orb1551863]
≥90% as determined by SDS-PAGE
This protein contains the human PEA15(Met1-Ala130) was fused without Tag and expressed in E. coli.
100 μg, 50 μgHuman PEA15 Protein [orb427604]
Greater than 90.0% as determined by SDS-PAGE.
Escherichia Coli
2 μg, 10 μg, 1 mg
