You have no items in your shopping cart.
Human PDI Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MRGSGSHHHHHHAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKA AGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN WLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNS DVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIK THILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL EEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEK KNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFP ASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL |
| Purity | Greater than 95.0% as determined by:a) Analysis by RP-HPLC.b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Protein Disulfide Isomerase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Human PDI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please avoid freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The PDI protein (1mg/ml)solution was lyophilized from PBS pH-7. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Protein Disulfide Isomerase A2 (PDIA2) ELISA Kit [orb775887]
Human
0.32-20 ng/mL
0.111 ng/mL
96 T, 48 THuman Protein Disulfide Isomerase A6 (PDIA6) ELISA Kit [orb777486]
Human
0.16-10 ng/mL
0.05 ng/mL
96 T, 48 THuman Protein Disulfide Isomerase A4 (PDIA4) ELISA Kit [orb778189]
Human
1.57-100 ng/mL
0.61 ng/mL
96 T, 48 THuman Protein Disulfide Isomerase A5 (PDIA5) ELISA Kit [orb777171]
Human
0.16-10 ng/mL
0.057 ng/mL
96 T, 48 THuman Protein Disulfide Isomerase (PDI) ELISA Kit [orb775533]
Human
0.32-20 ng/mL
0.11 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Oberčkal, Jernej et al. On the role of protein disulfide isomerase in the retrograde cell transport of secreted phospholipases A2 PLoS One, 10, e0120692 (2015)
Human PDI Protein (orb90210)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



