You have no items in your shopping cart.
Cart summary
Human PDGFRB Protein
Catalog Number: orb1477114
| Catalog Number | orb1477114 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Platelet-derived growth factor receptor beta(PDGFRB),partial |
| Tag | N-terminal 6xHis-GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 54.6 kDa |
| UniProt ID | P09619 |
| Protein Sequence | GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 901-1106aa. Protein Length: Partial |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | (PDGF-R-beta)(PDGFR-beta)(Beta platelet-derived gr Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human PDGF R beta / CD140b Protein [orb1146967]
Unconjugated
95%
83.1 kDa
Human PDGF R beta, Fc Tag (orb1146967) is expressed from human 293 cells (HEK293). It contains AA Leu 33 - Phe 530 (Accession # P09619-1).
1 mg, 100 μgRecombinant Human CD140B/PDGFRB Protein, His Tag [orb1553306]
≥90% as determined by SDS-PAGE
This protein contains the human PDGFRB(Met1-Lys531) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human PDGFR-β/PDGFRB Protein, His Tag [orb1551874]
≥90% as determined by SDS-PAGE
This protein contains the human PDGFRB(Leu33-Phe530) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgCanine PDGF R beta / CD140b Protein, His Tag [orb1710808]
Unconjugated
95%
58.0 kDa
Canine PDGF R beta Protein, His Tag (orb1710808) is expressed from human 293 cells (HEK293). It contains AA Leu 33 - Val 532 (Accession # Q6QNF3-1).
1 mg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars