You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PDCD1LG2 protein
Catalog Number: orb604300
| Catalog Number | orb604300 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Programmed cell death 1 ligand 2(PDCD1LG2),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 15.1 kDa |
| UniProt ID | Q9BQ51 |
| Protein Sequence | FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 21-118aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Butyrophilin B7-DC (B7-DC) (CD_antigen, CD273) (B7 Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human PD-L2 Protein, Fc Tag [orb257768]
Unconjugated
95%
49.2 kDa
Human PD-L2, Fc Tag (HPLC verified) (orb257768) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 219 (Accession # AAI13679).
1 mg, 100 μg - Item 1 of 2
Human PD-L2 Protein, mFc Tag [orb334918]
Unconjugated
95%
48.9 kDa
Human PD-L2, Mouse IgG1 Fc Tag (orb334918) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 219 (Accession # AAI13679).
1 mg, 100 μg - Item 1 of 2
Recombinant human PDCD1LG2 protein, C-His-Avi (HEK293) [orb1516350]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 40-52 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 1
Human PD-L2 Protein, His Tag [orb257767]
Unconjugated
95%
23.4 kDa
Human PD-L2, His Tag (SPR verified) (orb257767) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 219 (Accession # AAI13679).
1 mg, 100 μg - Item 1 of 1
Mouse PD-L2 Protein, His Tag [orb348790]
Unconjugated
95%
24.4 kDa
Mouse PD-L2, His Tag (orb348790) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Arg 219 (Accession # NP_067371).
1 mg, 100 μg
