You have no items in your shopping cart.
Human Parkin protein
SKU: orb244427
Featured
Description
Research Area
Cell Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 67.6 kDa |
| Expression Region | 1-465aa |
| Protein Length | Full Length |
| Protein Sequence | MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−E3 ubiquitin ligase protein, E3 ubiquitin protein ligase parkin protein, E3 ubiquitin-protein ligase parkin protein, LPRS 2 protein, LPRS2 protein, PARK 2 protein, PARK2 protein, Parkin 2 protein, Parkinson disease (autosomal recessive juvenile) 2 protein, Parkinson disease (autosomal recessive, juvenile) 2, parkin protein, Parkinson disease protein 2 protein, Parkinson juvenile disease protein 2 protein, Parkinson protein 2 E3 ubiquitin protein ligase protein, Parkinson protein 2, E3 ubiquitin protein ligase (parkin) protein, PRKN 2 protein, PRKN protein, PRKN2 protein
Similar Products
−Human G Protein Coupled Receptor 37 (GPR37) ELISA Kit [orb776980]
Human
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 THuman Parkinson Disease Protein 2 (PARK2) ELISA Kit [orb780565]
Human
0.16-10 ng/mL
0.053 ng/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human Parkin protein (orb244427)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








