You have no items in your shopping cart.
Human p16-INK4a Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cyclin-dependent kinase should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | CDKN2A was lyophilized from a concentrated (1mg/ml) sterile solution containing 1x PBS pH-7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human p16(44-72) Protein, hFc Tag [orb1743260]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 29.3 kDa after removal of the signal peptide. The apparent molecular mass of hFc-p16(44-72) is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgp16 INK4a (Phospho-S152) Rabbit Polyclonal Antibody [orb235087]
IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μlHuman p16(110-139) Protein, hFc Tag [orb1743258]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 29.4 kDa after removal of the signal peptide. The apparent molecular mass of hFc-p16(110-139) is approximately 25-35 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman p16(77-106) Protein, hFc Tag [orb1743259]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 29.4 kDa after removal of the signal peptide. The apparent molecular mass of hFc-p16(77-106) is approximately 25-35 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Human p16-INK4a Protein (orb427509)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








