You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human Oxytocin protein
Catalog Number: orb605364
| Catalog Number | orb605364 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Oxytocin-neurophysin 1(OXT) |
| Tag | N-terminal 6xHis-sumostar-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 26.9 kDa |
| UniProt ID | P01178 |
| Protein Sequence | CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
| Protein Length | Full Length of Mature Protein |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-125aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Ocytocin Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human OXT protein [orb419047]
Greater than 90% as determined by SDS-PAGE.
29.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Human OXT protein [orb419173]
Greater than 85% as determined by SDS-PAGE.
14.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human OXT protein [orb419012]
Greater than 90% as determined by SDS-PAGE.
11.6 kDa
Yeast
1 mg, 20 μg, 100 μg
