You have no items in your shopping cart.
Human OTOR Protein
SKU: orb427501
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl. |
| Disclaimer | For research use only |
Alternative Names
−Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Similar Products
−Otoraplin (OTOR) (NM_020157) Human Recombinant Protein [orb3047410]
> 80% as determined by SDS-PAGE and Coomassie blue staining
11.5 kDa
20 μg, 100 μg, 1 mg
RecombinantOTOR,Human [orb1494780]
> 95% by SDS-PAGE analysis.
12.7 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinantOTOR,Human [orb1494671]
> 95% as analyzed by SDS-PAGE.
14-15 kDa, observed by reducing SDS-PAGE.
CHO
10 μg, 50 μg, 1 mgRecombinant Human Melanoma Inhibitor Activity Protein 2 (rHuMIA-2) [orb1494951]
>97% by SDS-PAGE and HPLC analyses.
11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Escherichia coli
1 mg, 5 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human OTOR Protein (orb427501)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days