You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605362 |
---|---|
Category | Proteins |
Description | Recombinant Human Oncostatin-M(OSM),partial |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 24.0 kDa |
UniProt ID | P13725 |
Protein Sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR |
Protein Length | Partial |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 26-220aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | MGC20461, ONCM_HUMAN, Oncostatin M, Oncostatin-M, Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, FC, ICC, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
> 97% as determined by SDS-PAGE and HPLC. | |
22.0 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
23.7 kDa | |
E.Coli |
> 95% as determined by SDS-PAGE and HPLC. | |
25.8 kDa | |
E.Coli |
Unconjugated | |
95% | |
25.8 kDa | |
Human Oncostatin M Protein, premium grade (orb257725) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Arg 252 (Accession # NP_065391.1). |