You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594849 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 11B(TNFRSF11B) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 44.65 kDa |
UniProt ID | O00300 |
Protein Sequence | ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | Expression Region: 22-401aa. Protein Length: Full Length of Mature Protein |
Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is less than 25 ng/ml. |
Expression Region | 22-401aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Tumor Necrosis Factor Receptor Superfamily Member Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
47.2 KDa | |
Mammalian |
Unconjugated | |
95% | |
44.4 kDa | |
Human Osteoprotegerin, His Tag (orb257888) is expressed from human 293 cells (HEK293). It contains AA Glu 22 - Leu 401 (Accession # NP_002537). |
Unconjugated | |
92% | |
70.2 kDa | |
Human Osteoprotegerin, Fc Tag (orb257890) is expressed from human 293 cells (HEK293). It contains AA Glu 22 - Leu 401 (Accession # NP_002537). |
Filter by Rating