Human OGN protein

SKU: orb383003

Description

This Human OGN protein spans the amino acid sequence from region 21-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-tagged Full Length

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 21-298aa
• Protein Length: Full Length of Mature Protein
• MW: 33.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF

Storage & Handling

• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Form/Appearance: Liquid: Tris/PBS-based buffer, 5%-50% glycerol.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Corneal keratan sulfate proteoglycan; DKFZP586P2421; MIME_HUMAN; Mimecan; Mimecan proteoglycan; OG; OGN; OIF; Osteoglycin; Osteoinductive factor; SLRR3A

Quick Database Links

UniProt

P20774