Human OGN protein

• Catalog Number: orb383003
• Category: Proteins
• Description: Recombinant human OGN protein.
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid: Tris/PBS-based buffer, 5%-50% glycerol.
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 33.7 kDa
• UniProt ID: P20774
• Protein Sequence: PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
• Protein Length: Full Length of Mature Protein
• Source: Yeast
• Expression System: Expression Region: 21-298aa. Protein Length: Full Length of Mature Protein
• Expression Region: 21-298aa
• Endotoxins: Not test.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Corneal keratan sulfate proteoglycan; DKFZP586P242
• Note: For research use only
• Application notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
• Expiration Date: 6 months from date of receipt.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Human OGN protein could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of Human OGN protein could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.

SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.