You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383003 |
---|---|
Category | Proteins |
Description | Recombinant human OGN protein. |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid: Tris/PBS-based buffer, 5%-50% glycerol. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF |
Protein Length | Full Length of Mature Protein |
UniProt ID | P20774 |
MW | 33.7 kDa |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Full Length |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 21-298aa |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Alternative names | Corneal keratan sulfate proteoglycan; DKFZP586P242 Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.
Greater than 90% as determined by SDS-PAGE. | |
35.7 kDa | |
E.coli |
> 90% as determined by SDS-PAGE. | |
15.92 kDa |