You have no items in your shopping cart.
Human NRG1 protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 7.0 kDa |
| Expression Region | 177-237aa |
| Protein Length | Partial of Isoform 12 |
| Protein Sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human NRG1 protein (Active) [orb359178]
> 97% as determined by SDS-PAGE and HPLC.
7.5 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman NRG1 protein (Active) [orb359182]
> 97% as determined by SDS-PAGE and HPLC.
7.4 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinant human NRG1-β1 protein (Active, E.coli) [orb2978609]
≥ 95% as determined by SDS-PAGE.
7.5 kDa
500 μg, 10 μg, 50 μgRecombinant Human Pro-neuregulin-1, membrane-bound isoform protein(NRG1) (Active) [orb1650594]
>96% as determined by SDS-PAGE and HPLC.
7.0 kDa
50 μg, 100 μg, 500 μg, 1 mg, 10 μg, 250 μgRecombinant Human Pro-neuregulin-1, membrane-bound isoform protein(NRG1) (Active) [orb1650595]
>97% as determined by SDS-PAGE and HPLC.
7.5 kDa
50 μg, 100 μg, 500 μg, 1 mg, 250 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SDS-PAGE analysis of Human NRG1 protein (Active)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human NRG1 protein (Active) (orb359179)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

