You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359179 |
---|---|
Category | Proteins |
Description | Recombinant human NRG1 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 96% as determined by SDS-PAGE and HPLC. |
MW | 7.0 kDa |
UniProt ID | Q02297 |
Protein Sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ |
Protein Length | Partial of Isoform 12 |
Source | E.Coli |
Expression System | Expression Region: 177-237aa. Protein Length: Partial of Isoform 12 |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg. |
Expression Region | 177-237aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | Pro-NRG1, ARIA, Breast cancer cell differentiation Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human NRG1 protein (Active)
> 97% as determined by SDS-PAGE and HPLC. | |
7.5 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
7.4 kDa | |
E.Coli |
Filter by Rating