Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human Noggin protein
Catalog Number orb427374
ReactivityHuman
ConjugationUnconjugated
Target Noggin
Alternative Names
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Lyophilized from a 0.2μm filtered solution in 30% CH3CN, 0.1% TFA.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Purity >95.0% as determined by SDS-PAGE.
Source Escherichia Coli.
Activity The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 μg/ml of Noggin, corresponding to a Specific Activity of 12,500-20,000units/mg
Product Description

Human Noggin protein 

Solubility (25°C)
Solubility (25°C) It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
Reviews
Write Your Own Review
You're reviewing:Human Noggin protein - orb427374
Your Rating