Human NECTIN2 protein

• Catalog Number: orb594862
• Category: Proteins
• Description: Recombinant Human Nectin-2(NECTIN2),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 36.58 kDa
• UniProt ID: Q92692
• Protein Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
• Protein Length: Partial of Isoform Alpha
• Source: Mammalian cell
• Expression System: Expression Region: 32-360aa. Protein Length: Extracellular Domain
• Biological Activity: Measured by its binding ability in a functional ELISA.①Immobilized Human PVRIG-mFc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 3.72 ug/ml.②Immobilized Human PVRIG-Fc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 2.914 ug/ml.
• Expression Region: 32-360aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Alternative names: Poliovirus Receptor-Related Protein 2; Herpes Viru
• Note: For research use only
• Application notes: Extracellular Domain
• Expiration Date: 6 months from date of receipt.