Human NECTIN2 protein

SKU: orb594862

Description

This Human NECTIN2 protein spans the amino acid sequence from region 32-360aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Extracellular Domain

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA.①Immobilized Human PVRIG-mFc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 3.72 ug/ml.②Immobilized Human PVRIG-Fc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 2.914 ug/ml.
• Tag: C-terminal 6xHis-tagged
• Molecular Weight: 36.58 kDa
• Expression Region: 32-360aa
• Protein Length: Partial of Isoform Alpha
• Protein Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Poliovirus Receptor-Related Protein 2; Herpes Virus Entry Mediator B; Herpesvirus Entry Mediator B; HveB; Nectin-2; CD112; PVRL2; HVEB; PRR2

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q92692