Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human MIF (His C) protein
Catalog Number orb427102
ReactivityHuman
ConjugationUnconjugated
Target MIF (His C)
Product Properties
Form/Appearance Sterile Filtered lyophilized powder.
Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.
Purity >95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Activity Measured by its ability to bind rhCD74 in a functional ELISA.
Product Description

Recombinant of human MIF (His C) protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Reviews
Write Your Own Review
You're reviewing:Human MIF (His C) protein - orb427102
Your Rating