You have no items in your shopping cart.
Human MIF (His C) Protein
SKU: orb427102
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Measured by its ability to bind rhCD74 in a functional ELISA. |
| Protein Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered lyophilized powder. |
| Buffer/Preservatives | Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. |
| Disclaimer | For research use only |
Alternative Names
−Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Similar Products
−Recombinant human AMH protein, C-His (HEK293) [orb1516591]
>90% as determined by SDS-PAGE
55-65 kDa
100 μg, 500 μg, 20 μgRecombinant Human MIF Protein, C-His [orb2969151]
>90% as determined by SDS-PAGE.
13.45 kDa
1 mg, 100 μg, 50 μgRecombinant human AMH protein, C-His [orb1975870]
>90% as determined by SDS-PAGE
20 kDa
100 μg, 500 μg, 20 μgRecombinant Human MIF Protein, C-His [orb2836388]
>90% as determined by SDS-PAGE.
13.45 kDa
20 μg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human MIF (His C) Protein (orb427102)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
