Human MIF (His C) Protein

• Catalog Number: orb427102
• Category: Proteins
• Description: Recombinant of human MIF (His C) protein
• Form/Appearance: Sterile Filtered lyophilized powder.
• Buffer/Preservatives: Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.
• Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Protein Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH
• Application notes: Cytokines And Growth Factors
• Source: Escherichia Coli
• Biological Activity: Measured by its ability to bind rhCD74 in a functional ELISA.
• Solubility (25°C): It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Storage: Stability: Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Alternative names: Phenylpyruvate tautomerase, Glycosylation-inhibiti
• Note: For research use only