You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359231 |
---|---|
Category | Proteins |
Description | Recombinant human MAOM active protein |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4. |
Purity | > 95% as determined by SDS-PAGE and HPLC. |
Protein Sequence | MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH |
Protein Length | Full Length of Mature Protein |
UniProt ID | P23368 |
MW | 64.4 kDa |
Application notes | This is His protein |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM |
Expression Region | 19-584aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | NAD-ME, Malic enzyme 2 |
Research Area | Signal Transduction |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human MAOM protein (Active)