You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245910 |
---|---|
Category | Proteins |
Description | Recombinant human Lymphocyte antigen 6 complex locus protein G6d |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 11.1 kDa |
UniProt ID | O95868 |
Protein Sequence | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Expression System | Expression Region: 20-104aa. Protein Length: Full Length of Mature Protein |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 2.816-3.741 ng/mL. |
Expression Region | 20-104aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Alternative names | LY6G6D Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
25.5 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
15.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
12.0 kDa | |
Yeast |
Filter by Rating