Human LY6G6D protein

• Catalog Number: orb245910
• Category: Proteins
• Description: Recombinant human Lymphocyte antigen 6 complex locus protein G6d
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
• Protein Length: Full Length of Mature Protein
• UniProt ID: O95868
• MW: 11.1 kDa
• Application notes: This is His-tag protein
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.
• Expression Region: 20-104aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: LY6G6D
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.