You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb705222 |
---|---|
Category | Proteins |
Description | Recombinant Human Lymphotoxin-alpha(LTA) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 20.8 kDa |
UniProt ID | P01374 |
Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 35-205aa |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml. |
Expression Region | 35-205aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 95% as determined by SDS-PAGE. | |
18.8 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
18.8 KDa | |
E. Coli |
Unconjugated | |
95% | |
48.8 kDa | |
Human LTBR, Fc Tag (orb1176544) is expressed from human 293 cells (HEK293). It contains AA Gln 31 - Met 227 (Accession # P36941-1). |
Filter by Rating