You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. |
| Purity | Greater than 97.0% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA |
Storage & Handling
−| Storage | Stability: Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human LR3-IGF-1 Protein [orb1471762]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
9.1 KDa
Mammalian
10 μg, 50 μgRecombinant Human LR3-IGF-1 Protein [orb3002469]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 9.1 KDa. Observed: 11 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant human LR3 IGF1 protein (Active, CHO) [orb2978615]
≥ 95% as determined by SDS-PAGE.
9 kDa
10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Human LR3 IGF1 Protein (orb168743)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review