Human LR3 IGF1 Protein

• Catalog Number: orb168743
• Category: Proteins
• Description: Recombinant of Human LR3 IGF1 protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 97.0% as determined by SDS-PAGE and HPLC.
• Solubility (25°C): It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
• Source: Escherichia Coli
• Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
• Storage: Stability: Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Buffer/Preservatives: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2.
• Alternative names: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LON
• Note: For research use only
• Application notes: Cytokines And Growth Factors
• Expiration Date: 6 months from date of receipt.