Human LGALS13 Protein

SKU: orb426856

Description

Recombinant of human LGALS13 protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Escherichia Coli
• Protein Sequence: MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
• Purity: Greater than 90.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
• Form/Appearance: Sterile Filtered colorless solution.
• Buffer/Preservatives: LGALS13 protein solution (0.5mg/ml) is formulated in 1xPBS buffer pH 7.4.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Galactoside-binding soluble lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, Placental protein 13, LGALS13, PLAC8, GAL13.