Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human LGALS13 Protein

SKU: orb426856

Description

Recombinant of human LGALS13 protein

Research Area

Cell Biology

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceEscherichia Coli
PurityGreater than 90.0% as determined by SDS-PAGE.
Protein SequenceMSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Storage & Handling

StorageStability: Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles
Form/AppearanceSterile Filtered colorless solution.
Buffer/PreservativesLGALS13 protein solution (0.5mg/ml) is formulated in 1xPBS buffer pH 7.4.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Galactoside-binding soluble lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, Placental protein 13, LGALS13, PLAC8, GAL13.

Similar Products

  • Human Placental Protein 13 (PP13) ELISA Kit [orb775800]

    Human

    15.63-1000 pg/mL

    6.1 pg/mL

    96 T, 48 T
  • Human Placental Protein 13 (PP13) ELISA Kit [orb1948471]

    Human

    15.63-1000pg/mL

    9.38 pg/mL

    48 T, 96 T
  • LGALS13 Rabbit Polyclonal Antibody [orb2953073]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Recombinant Human LGALS13 Protein, N-GST [orb2967164]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    42.94 kDa

    1 mg, 50 μg, 100 μg
  • Human Galectin 13 protein [orb756308]

    ELISA,  WB

    Greater than 95% as determined by SDS-PAGE

    15.2 kDa

    E.Coli

    100 μg, 50 μg, 200 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human LGALS13 Protein (orb426856)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 250.00
100 μg
$ 350.00
1 mg
$ 1,890.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry