You have no items in your shopping cart.
Human LGALS13 Protein
SKU: orb426856
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGK QFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
| Purity | Greater than 90.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered colorless solution. |
| Buffer/Preservatives | LGALS13 protein solution (0.5mg/ml) is formulated in 1xPBS buffer pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−Galactoside-binding soluble lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, Placental protein 13, LGALS13, PLAC8, GAL13.
Similar Products
−- Item 1 of 1
- Item 1 of 1
Galectin 13 (LGALS13) (NM_013268) Human Recombinant Protein [orb3047920]
> 80% as determined by SDS-PAGE and Coomassie blue staining
15.9 kDa
20 μg, 100 μg, 1 mgRecombinant Human LGALS13 Protein, N-GST [orb2967164]
>90% as determined by SDS-PAGE.
42.96 kDa
1 mg, 100 μg, 50 μgHuman Galectin 13 protein [orb756308]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
15.2 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human LGALS13 Protein (orb426856)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days