You have no items in your shopping cart.
Human KKLC1 protein
SKU: orb358909
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 14 kDa |
| Expression Region | 1-113aa |
| Protein Length | Full Length |
| Protein Sequence | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−(KK-LC-1)(Cancer/testis antigen 83)
Similar Products
−- Item 1 of 1
Human CT83 Protein, hFc Tag [orb1290991]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.7 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CT83 is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Detected by Mouse anti-6*His monoclonal antibody.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human KKLC1 protein (orb358909)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks