You have no items in your shopping cart.
Description
Research Area
Cancer Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions) |
| Expression Region | 1-113aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 14 kDa |
| Protein Sequence | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(KK-LC-1)(Cancer/testis antigen 83)
Similar Products
−- Item 1 of 1
CT83/KK-LC-1 Mouse Monoclonal Antibody [orb2958781]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 1
KKLC1 rabbit pAb Antibody [orb771944]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
Human CT83 Protein, hFc Tag [orb1290991]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.7 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CT83 is approximately 25-35 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks