Human KKLC1 protein

• Catalog Number: orb358909
• Category: Proteins
• Description: Recombinant human KKLC1 protein
• Tag: N-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
• Form/Appearance: Lyophilized powder
• Purity: Testing in progress.
• MW: 14 kDa
• UniProt ID: Q5H943
• Protein Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
• Protein Length: Full Length
• Source: Mammalian cell
• Expression System: Expression Region: 1-113aa. Protein Length: Full Length
• Expression Region: 1-113aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: (KK-LC-1)(Cancer/testis antigen 83)
• Note: For research use only
• Application notes: Full length of HIS-tag and expression region is 20.63kDa
• Expiration Date: 6 months from date of receipt.