You have no items in your shopping cart.
Human ITGAV protein
SKU: orb245891
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 19.7 kDa |
| Expression Region | 891-1048aa |
| Protein Length | Partial |
| Protein Sequence | DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−ITGAV
Similar Products
−- Item 1 of 4
- Item 1 of 2
Recombinant human Lntegrin Alpha V Beta 3 (ITGAV & ITGB3) protein, C-His-Avi (HEK293) [orb1516400]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation,the protein migrates to 85-140 kDa based on Tris-Bis PAGE result.
50 μg 
CD51 (ITGAV) (NM_001144999) Human Recombinant Protein [orb3033505]
>80% as determined by SDS-PAGE and Coomassie blue staining
25.7 kDa
50 μg, 1 mg- Item 1 of 1
Human ITGAV & ITGB1 Heterodimer Protein, His Tag & hFc Tag [orb1291080]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 107.1 and 104.5 kDa after removal of the signal peptide. The apparent molecular mass of ITGAV-His and ITGB1-hFc is approximately 130-250 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg Recombinant Human CD51/ITGAV Protein, N-His [orb2969457]
>90% as determined by SDS-PAGE.
22.94 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human ITGAV protein (orb245891)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-6 weeks