Human ITGAV protein

Catalog Number: orb245891

Catalog Number	orb245891
Category	Proteins
Description	Recombinant human Integrin alpha-V
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	19.7 kDa
UniProt ID	P06756
Protein Sequence	DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Protein Length	Partial
Source	Yeast
Expression System	Expression Region: 891-1048aa. Protein Length: Partial
Expression Region	891-1048aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	ITGAV Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 107.1 and 100.4 kDa after removal of the signal peptide. The apparent molecular mass of ITGAV-His abd ITGB6-hFc is approximately 130-250 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 107.1 and 104.5 kDa after removal of the signal peptide. The apparent molecular mass of ITGAV-His and ITGB1-hFc is approximately 130-250 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Purity:	> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
Source:	KMP2035, Recombinant Human Integrin ITGAV & ITGB5 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Phe31-Val992(P06756) acidic tail&Gly24-Asn719(P18084) basic tail) of Human Integrin ITGAV & ITGB5 fused with His Tag and Avi tag at the C-terminal.

Sizes Available: 500 μg, 100 μg

Purity:	> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
Source:	KMP2033, Recombinant Human Integrin ITGAV & ITGB3 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Phe31-Val992(P06756) acidic tail&GLy27-Asp718(P05106) basic tail) of Human Integrin ITGAV & ITGB3 fused with His Tag and Avi tag at the C-terminal.

Sizes Available: 500 μg, 100 μg

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human ITGAV(Met1-Val992) was fused with the C-terminal His Tag and expressed in Mammalian cells.