You have no items in your shopping cart.
Human ITGAV protein
SKU: orb245891
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 19.7 kDa |
| Expression Region | 891-1048aa |
| Protein Length | Partial |
| Protein Sequence | DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−ITGAV
Similar Products
−- Item 1 of 4
- Item 1 of 2
Recombinant human Lntegrin Alpha V Beta 3 (ITGAV & ITGB3) protein, C-His-Avi (HEK293) [orb1516400]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation,the protein migrates to 85-140 kDa based on Tris-Bis PAGE result.
50 μg 
CD51 (ITGAV) (NM_001144999) Human Recombinant Protein [orb3033505]
>80% as determined by SDS-PAGE and Coomassie blue staining
25.7 kDa
50 μg, 1 mg- Item 1 of 1
Human ITGAV & ITGB1 Heterodimer Protein, His Tag & hFc Tag [orb1291080]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 107.1 and 104.5 kDa after removal of the signal peptide. The apparent molecular mass of ITGAV-His and ITGB1-hFc is approximately 130-250 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human ITGAV and ITGB5 Heterodimer Protein, His Tag and hFc Tag [orb2321406]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 107.1 and 102.7 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human ITGAV protein (orb245891)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-6 weeks