Human ISCU protein

SKU: orb54431

Description

Recombinant human ISCU protein

Research Area

Metabolism Research

Images & Validation

• Application Notes:
  N-terminal GST-tagged: N-terminal GST-tagged1-308AA: 1-167AAFull Length : Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged
• Molecular Weight: 18.0 kDa
• Expression Region: 35-167aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

Quick Database Links

UniProt

Q9H1K1