You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb80254 |
---|---|
Category | Proteins |
Description | Recombinant of Human Interferon gamma protein |
Form/Appearance | Filtered White lyophilized (freeze-dried) powder. |
Buffer/Preservatives | Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5. |
Purity | Greater than 90% as determined by SDS PAGE. |
Protein Sequence | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
Application notes | Cytokines And Growth Factors |
Source | E. Coli |
Solubility (25°C) | Add deionized water and let the lyophilized pellet dissolve completely. |
Storage | Stability: For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C |
Alternative names | AIF-1, Allograft inflammatory factor 1, Em:AF12975 Read more... |
Note | For research use only |
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
> 97% as determined by SDS-PAGE and HPLC. | |
11.7 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.6 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.3 kDa | |
E.Coli |