You have no items in your shopping cart.
Human Interferon gamma Protein
SKU: orb80254
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E. Coli |
|---|---|
| Protein Sequence | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
| Purity | Greater than 90% as determined by SDS PAGE. |
Storage & Handling
−| Storage | Stability: For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C |
|---|---|
| Form/Appearance | Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
Similar Products
−Human Interferon Gamma Induced Protein 10kDa (IP10) ELISA Kit [orb775143]
Human
15.63-1000 pg/mL
6 pg/mL
96 T, 48 THuman Interferon Inducible T-Cell Alpha Chemoattractant (ITaC) ELISA Kit [orb775209]
Human
62.5-4000 pg/mL
23 pg/mL
48 T, 96 THuman Interferon Gamma Inducible Protein 30 (IFI30) ELISA Kit [orb777067]
Human
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 THuman Gamma-Interferon-Inducible Protein 16 (IFI16) ELISA Kit [orb1173603]
Human
0.16-10 ng/mL
0.064 ng/mL
48 T, 96 THuman Tryptophanyl tRNA Synthetase (WARS) ELISA Kit [orb779034]
Human
1.57-100 ng/mL
0.58 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human Interferon gamma Protein (orb80254)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



