Human INSR protein

Catalog Number: orb8257

Catalog Number	orb8257
Category	Proteins
Description	Recombinant of human INSR protein
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	47.2 kDa
UniProt ID	P06213
Protein Sequence	ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 1023-1298aa. Protein Length: Partial
Expression Region	1023-1298aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	CD_antigen, CD220 Read more...
Note	For research use only
Application notes	Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1023-1298aaSequence Info: PartialGlycerol content: 0.5
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	90%
MW:	83.6 kDa and 22.8 kDa
Source:	Human Insulin R (28-944), His Tag (orb545724) is expressed from human 293 cells (HEK293). It contains AA His 28 - Lys 944 (Accession # P06213-2).

Sizes Available: 100 μg, 1 mg

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human INSR(Met1-Ser758) was fused with the C-terminal His Tag and expressed in Mammalian cells.