You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244862 |
---|---|
Category | Proteins |
Description | Recombinant human Immunoglobulin-like domain-containing receptor 2 |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 48.1 kDa |
UniProt ID | Q71H61 |
Protein Sequence | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 1-186aa. Protein Length: Extracellular Domain |
Expression Region | 1-186aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | ILDR2 Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
23.1 kDa | |
Yeast |
The human full length ILDR2 protein has a MW of 71.2 kDa | |
Mammalian |
Unconjugated | |
95% | |
45.1 kDa | |
Human ILDR2, Fc Tag (orb669286) is expressed from human 293 cells (HEK293). It contains AA Leu 21 - Glu 186 (Accession # Q71H61-1). |
Filter by Rating