You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL6R protein
Catalog Number: orb358335
| Catalog Number | orb358335 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL6R protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 40.5 kDa |
| UniProt ID | P08887 |
| Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-365aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Interleukin 6 receptor, isoform CRA_a Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human IL-6 R alpha Protein, His Tag [orb257625]
Unconjugated
95%
39.4 kDa
Human IL-6 R alpha, His Tag (orb257625) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 365 (Accession # NP_000556.1).
1 mg, 50 μg - Item 1 of 1
Human IL-6 R alpha Protein, Fc Tag [orb570285]
Unconjugated
95%
65.0 kDa
Human IL-6 R alpha, Fc Tag (orb570285) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 365 (Accession # P08887-1).
100 μg, 1 mg - Item 1 of 1
- Item 1 of 1
Human IL6R Protein, His Tag [orb757423]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.4 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
Human IL6R Protein, hFc Tag [orb757474]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 64.7 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg
