You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL6R protein
Catalog Number: orb358335
| Catalog Number | orb358335 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL6R protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
| Protein Length | Partial |
| UniProt ID | P08887 |
| MW | 40.5 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-365aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin 6 receptor, isoform CRA_a |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Recombinant human IL-6R protein, C-His-Avi (HEK293) [orb1516404]
> 95% as determined by Tris-Bis PAGE; > 94% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 65-78 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human IL-6R protein, C-His-Avi (HEK293), Biotin conjugated [orb2328748]
> 95% as determined by Tris-Bis PAGE; > 94% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 70-80 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 1
Human IL6R Protein, His Tag [orb757423]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.4 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
Human IL6R Protein, hFc Tag [orb757474]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 64.7 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
