Human IL20RB protein

• Catalog Number: orb604985
• Category: Proteins
• Description: Recombinant Human Interleukin-20 receptor subunit beta (IL20RB),partial
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 26.9 kDa
• UniProt ID: Q6UXL0
• Protein Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
• Protein Length: Partial
• Source: E.coli
• Expression System: Expression Region: 30-233aa. Protein Length: Partial
• Expression Region: 30-233aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Fibronectin type III domain containing 6 (FNDC6) (
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.