Human IL17B protein (Active)

SKU: orb358964

Description

This Human IL17B protein (Active) spans the amino acid sequence from region 21-180aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of ＞ 1000 IU/mg.
• Tag: Tag-Free
• Molecular Weight: 18.3 kDa
• Expression Region: 21-180aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose
• Disclaimer: For research use only

Alternative Names

IL-17B, Interleukin-20, IL-20, Neuronal interleukin-17-related factor,

Quick Database Links

UniProt

Q9UHF5