Cart summary

You have no items in your shopping cart.

Human IL17A & IL17F protein

Catalog Number: orb594824

DispatchUsually dispatched within 1-2 weeks
$ 340.00
Catalog Numberorb594824
CategoryProteins
DescriptionRecombinant Human Interleukin-17A & Interleukin-17F(IL17A & IL17F) (Active)
TagC-terminal 6xHis-tagged
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Protein LengthHeterodimer
UniProt IDQ16552
MW15.1kDa & 16.0 kDa
Application notesHeterodimer
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological Activity①Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay. ②Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay.
Expression Region24-155aa & 31-163aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesIL‑17A/F Heterodimer;IL-17A&IL-17F Heterodimer
NoteFor research use only
Human IL17A & IL17F protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.