You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594793 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-15(IL15) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.5 kDa |
UniProt ID | P40933 |
Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | 49-162aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml. |
Expression Region | 49-162aa |
Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0 |
Alternative names | Interleukin-15; IL-15; IL15 Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
12.9 kDa | |
E.Coli |
Unconjugated | |
90% | |
19.9 kDa | |
Human Flt-3 Ligand, His Tag (orb257477) is expressed from human 293 cells (HEK293). It contains AA Thr 27 - Pro 185 (Accession # P49771-1). |
Unconjugated | |
95% | |
44.8 kDa | |
Human IL-15 R alpha, Fc Tag (orb570279) is expressed from human 293 cells (HEK293). It contains AA Ile 31 - Thr 205 (Accession # Q13261-1). |
Unconjugated | |
90% | |
19.9 kDa | |
Human Flt-3 Ligand, His Tag (orb511237) is expressed from Baculovirus-Insect cells. It contains AA Thr 27 - Pro 185 (Accession # P49771-1). |
Unconjugated | |
90% | |
14.8 kDa | |
Human IL-15, His Tag (orb864189) is expressed from human 293 cells (HEK293). It contains AA Asn 49 - Ser 162 (Accession # P40933-1). |
Filter by Rating