You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605342 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-1 alpha(IL1A) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 20.0 kDa |
UniProt ID | P01583 |
Protein Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Expression System | Expression Region: 113-271aa. Protein Length: Full Length of Mature Protein |
Expression Region | 113-271aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Hematopoietin-1 (IL-1 alpha) (IL1F1) Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
18.0 kDa | |
E.Coli |
Unconjugated | |
95% | |
62.4 kDa | |
Human IL-18 R1, Fc Tag (orb257584) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Arg 329 (Accession # AAH69575). |
Unconjugated | |
95% | |
19.9 kDa | |
Human IL-1 alpha, His Tag (orb867311) is expressed from human 293 cells (HEK293). It contains AA Ser 113 - Ala 271 (Accession # P01583-1). |
Biotin | |
95% | |
39.3 kDa | |
Biotinylated Human IL-18 R1, His, (orb1184767) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Arg 329 (Accession # Q13478-1). |
Biotin | |
95% | |
63.9 kDa | |
Biotinylated Human IL-18 R1, Fc, (orb1152438) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Arg 329 (Accession # AAH69575.1). |
Filter by Rating