You have no items in your shopping cart.
Human IL 1 beta (His) Protein
SKU: orb426418
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. |
| Disclaimer | For research use only |
Alternative Names
−Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Similar Products
−Recombinant Human CD121b/IL1R2/IL-2R beta Protein, N-His [orb2962996]
>90% as determined by SDS-PAGE.
38.98 kDa
1 mg, 100 μg, 50 μgRecombinant Human IL1B/IL1F2 Protein, C-His [orb2969638]
>90% as determined by SDS-PAGE.
18.3 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL 1 beta (His) Protein (orb426418)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
