Cart summary

You have no items in your shopping cart.

Human IL 1 beta (His) Protein

SKU: orb426418

Description

Recombinant of human IL 1 beta (His) protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceEscherichia Coli
Protein SequenceAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
PurityGreater than 95.0% as determined by SDS-PAGE.

Storage & Handling

StorageStability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles
Form/AppearanceSterile Filtered clear solution.
Buffer/PreservativesIL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human IL 1 beta (His) Protein (orb426418)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
20 μg
$ 350.00
1 mg
$ 7,440.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry