Human IL 1 beta (His) Protein

SKU: orb426418

Description

Recombinant of human IL 1 beta (His) protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Escherichia Coli
• Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Purity: Greater than 95.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles
• Form/Appearance: Sterile Filtered clear solution.
• Buffer/Preservatives: IL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.